Keywords

• Sermorelin
• 86168-78-7
• C149H246N44O42S

Quick Details

• ProName: Sermorelin86168-78-7C149H246N44O42S
• CasNo: 86168-78-7
• Molecular Formula: C149H246N44O42S
• Appearance: detailed in specifcations
• Application: Aripiprazole Intermediate functional...
• DeliveryTime: within 5days
• PackAge: as needed
• Port: China main port
• ProductionCapacity: 500 Metric Ton/Month
• Purity: 99%
• Storage: Keep in dry and cool condition
• Transportation: by air or sea
• LimitNum: 1 Kilogram
• MF: C13H21O3PS

Superiority

Our Services

1.Certificate Of Analysis (COA)

2.Material Safety Data Sheet (MSDS)

3.Route of synthesis (ROS)

4.Method of Aanlysis (MOA)

5.Nuclear Magnetic Resonance (NMR)

6.Packing pictures and loading video before loading

7.Free Sample

9.Factory audit

10.Strong after-sale service

Company information

Henan Sunlake Enterprise Corporation is located in Henan Province , The central plain of China , Which enjoys favorable geogeaphical position and convenient transportion, The com[any was established in june. 1998 , until now having more than 18 years experience in manufacturing & exporting chemical raw material .Sunlake is a professional manufacturer engaged in producing and selling chemicals,including Organic & inorganic chemicals , pigments & Dyestuffs , Water treatment chemicals , Food & FEED additives and others . these products have been being well exported to europe , southeast Asia , the Middle East , Africa , South America and some other countries and areas.We sincerely welcome foreign friends to visit our plant for cooperation. With the idea of "quality first,credit priority, Excellent service", We are highly acknowledged by customers for good quality and competitive price. More importantly , the company has a strong R & D team, who are professional engineers and scholars with Ph. D. .So we are confident to serve you better with our high - quality products and professional team.We are taking great efforts to provide our customers with demanded goods and professional services, and continuously improve our core ability of competition and get the momentum for sustainable development, and finally make us being a reliable and professional wupplier in international market.We welcome any serious inquiries from all customers of the world, and sincerely hope to cooperate.

Details

Sermorelin Basic information

Product Name:	Sermorelin
Synonyms:	SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN;GRF (1-29) AMIDE (HUMAN)
CAS:	86168-78-7
MF:	C149H246N44O42S
MW:	3357.88
EINECS:
Product Categories:	Amino Acid Derivatives;Peptide;GH-RHObesity Research;GH-RHPeptides for Cell Biology;Growth Hormone Releasing Factors;Neuropeptides;Neurotransmission (Obesity);Releasing Factors
Mol File:	86168-78-7.mol

Sermorelin Chemical Properties

storage temp.	−20°C
CAS DataBase Reference	86168-78-7(CAS DataBase Reference)

Safety Information

WGK Germany

3

MSDS Information

Provider	Language
SigmaAldrich	English

Sermorelin Usage And Synthesis

Usage

xanthine oxidase inhibitor

Sermorelin Preparation Products And Raw materials