Welcome to LookChem.com Sign In|Join Free

HENAN SUNLAKE ENTERPRISE CORPORATION

Free supplier Enterprise Certification

Free
supplier
9th
years
Home>>Products>>Exendin-4

Product Certification&
Enterprise Certification

More Detail

HENAN SUNLAKE ENTERPRISE CORPORATION

Country: China (Mainland)

Business Type:Trading Company

Ms.Tina

Tel: 86-371-86259723

Mobile:

Tel: 86-371-86259723

Fax: +86-371- 86259723

Province/state: HENAN

City: ZHENGZHOU

Street: Mingmen International Center, NO.222 Dongming Road,Zhengzhou,Henan,China

MaxCard:


qq Contact Suppliers

Exendin-4

CAS NO.141758-74-9

  • Min.Order: 1 Kilogram
  • Payment Terms: L/C,D/A,D/P,T/T,Other
Contact Supplier

Product Details

Keywords

  • Exendin-4
  • 141758-74-9
  • C184H282N50O60S1

Quick Details

  • ProName: Exendin-4
  • CasNo: 141758-74-9
  • Molecular Formula: C184H282N50O60S1
  • Appearance: powder
  • Application: 141758-74-9
  • DeliveryTime: within 3-7 days
  • PackAge: as requested
  • Port: China Main Port
  • ProductionCapacity: 300 Kilogram/Month
  • Purity: 98%
  • Storage: store in cool, dry place
  • Transportation: by sea or by air
  • LimitNum: 1 Kilogram

Superiority

Exendin-4 Basic information  New diabetes drugsUses
Product Name: Exendin-4 Synonyms: ;;;;;;H-HIS-GLY-GLU-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2EXENDIN-4M.W. 4186.61 C184H282N50O60SExenatide, AC 2993, Exendin A, ExendinAH-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2Exendin-4 Exenatide CAS: 141758-74-9 MF: C184H282N50O60S1 MW: 4186.57 EINECS:   Product Categories: ;;;;;;;;;;;PeptideCytokines Growth Factors and Hormones (Obesity)ExendinPeptides for Cell BiologyGLP-1 Receptor LigandsCell Signaling and NeuroscienceLizardObesity ResearchObesity PeptidesOther Obesity Research ProductsHormonesObesity ResearchToxins and VenomsGlucagon receptor and relatedPeptide Receptors Mol File: Mol File Exendin-4 Structure
  Exendin-4 Chemical Properties
storage temp.  −20°C
  Safety Information
WGK Germany  3
MSDS Information
Provider Language SigmaAldrich English
  Exendin-4 Usage And Synthesis
New diabetes drugs Diabetes is a metabolic disorder characterized by chronic hyperglycemia caused by a variety of causes , high blood sugar is caused by insulin secretion or its effect defect. Diabetes can be divided into type 1 diabetes, type 2 diabetes, other specific types of diabetes, and gestational diabetes, among which type 2 diabetes account for more than 90%. Exendin-4 is a new diabetes drug successfully developed by American Eli Lilly Company it belongs to incretin analogues, it is the first member of the incretin analogues family , it is the synthetic peptide compound, which can simulate physiological behavior of the natural state secretion of GLP-1 in vivo ,it is similar to human pancreatic glucagon-like peptide effect -1 (GLP-1),it can promote glucose-dependent insulin secretion, it has inhibition effect of inappropriate glucose-dependent glucagon secretion, slowing gastric emptying, it improves the sensitivity of peripheral tissues to insulin, and it makes blood sugar adequately controlled. Clinically it is used for the treatment of type Ⅱ diabetes patients whose blood sugar is unbale to be controlled by metformin, sulfonylurea, or combination of metformin and sulfonylurea. From April 28, 2005 to October 29, 2008, the US Food and Drug Administration (abbreviation: FDA) Adverse Event Reporting System had received reports of 78 cases of patients with renal exenatide change. In the meantime, the United States had made a total of more than 6.6 million Exendin-4 prescription, therefore, FDA thought the received 78 cases was in a small proportion of the proportion of all patients reporting use of the drug. Currently FDA has completed an assessment of these reported cases, including 62 cases of acute renal failure cases and 16 cases of renal insufficiency cases. Acute renal failure or renal dysfunction occurs three days to two years after treatment. The age span is 23 years to 83 years, mean age is 60 years. The above information is edited by the chemicalbook of Tian Ye.


Uses Exendin-4 can activate the GLP-1 receptor, the receptor can increase cAMP levels of pancreatic acinar cells in intracellular , but it has no effect on VIP receptor.
  Exendin-4 Preparation Products And Raw materials

 

Details

Exhibition in shanghai

We have clients throughout the world:

Professional service and rich experience make customers

feel at ease, adequate stock and fast delivery meet your

desire.

 

 

Our Laboratoy

We have our own independent lab test center:

This makes sure that our technology support is reliable

and authoritative.All of self-owned fine chemicals are

manufactured strictly in accordance with international

standard.,and also has scientific cooperation with local

colleges and institutes.

 

 

Our factory

High quality with competitive price:

We are manufacturer and can provide high quality products

with factory price.

 

 

Package  & Shipment

Fast and safe delivery:

Parcels can be sent out within 24 hours after payment.

Tracking number is available secure and discreet shipment.

You have various choices of transportation methods.

 
Hot Product